PDB entry 5e3f

View 5e3f on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS I92K at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, pdTp, hydrolase, ionizable group
Deposited on 2015-10-02, released 2015-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (43-44)
      • engineered mutation (85)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d5e3fa_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5e3fA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
enakkievefdkgqrtdkygrglaykyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >5e3fA (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglaykyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws