PDB entry 5cai

View 5cai on RCSB PDB site
Description: Crystal structure of a putative lipoprotein from the DUF903 family (KPN_03160) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 2.30 A resolution
Class: lipid-binding protein
Keywords: lipoprotein, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, LIPID-BINDING PROTEIN
Deposited on 2015-06-29, released 2015-07-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative lipoprotein from the DUF903 family
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: ygdI, YP_001336791.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5caia_
  • Chain 'B':
    Compound: Putative lipoprotein from the DUF903 family
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: ygdI, YP_001336791.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5caib_
  • Chain 'C':
    Compound: Putative lipoprotein from the DUF903 family
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: ygdI, YP_001336791.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5caic_
  • Chain 'D':
    Compound: Putative lipoprotein from the DUF903 family
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: ygdI, YP_001336791.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5caid_
  • Chain 'E':
    Compound: Putative lipoprotein from the DUF903 family
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: ygdI, YP_001336791.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5caie_
  • Chain 'F':
    Compound: Putative lipoprotein from the DUF903 family
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: ygdI, YP_001336791.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5caif_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5caiA (A:)
gcssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgelde

    Sequence, based on observed residues (ATOM records): (download) 
    >5caiA (A:)
ssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5caiB (B:)
gcssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgelde

    Sequence, based on observed residues (ATOM records): (download) 
    >5caiB (B:)
ssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >5caiC (C:)
gcssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgelde

    Sequence, based on observed residues (ATOM records): (download) 
    >5caiC (C:)
snyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >5caiD (D:)
gcssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgelde

    Sequence, based on observed residues (ATOM records): (download) 
    >5caiD (D:)
ssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >5caiE (E:)
gcssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgelde

    Sequence, based on observed residues (ATOM records): (download) 
    >5caiE (E:)
snyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >5caiF (F:)
gcssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgelde

    Sequence, based on observed residues (ATOM records): (download) 
    >5caiF (F:)
ssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld