PDB entry 5bq1

View 5bq1 on RCSB PDB site
Description: Capturing Carbon Dioxide in beta Carbonic Anhydrase
Class: lyase
Keywords: Carbonic Anhydrase, Metalloenzyme, LYASE
Deposited on 2015-05-28, released 2015-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PAMH19_3356
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5bq1a1, d5bq1a2
  • Heterogens: ZN, CO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5bq1A (A:)
alqqlfennvrwaeaikqedpdffaklarqqtpeylwigcsdarvpaneivgmlpgdlfv
hrnvanvvlhtdlnclsviqfavdvlkvkhilvtghygcggvraslhndqlglidgwlrs
irdlayeyrehleqlpteeervdrlcelnviqqvanvshtsivqnawhrgqslsvhgciy
gikdglwknlnvtvsgldqlppqyrlspl