PDB entry 5af5

View 5af5 on RCSB PDB site
Description: Structure of Lys33-linked triUb S.G. P 212121
Class: signaling protein
Keywords: signaling protein, signalling protein, ubiquitin
Deposited on 2015-01-19, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (0-72)
      • engineered mutation (10)
    Domains in SCOPe 2.06: d5af5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5af5A (A:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrl