PDB entry 5af5

View 5af5 on RCSB PDB site
Description: Structure of Lys33-linked triUb S.G. P 212121
Class: signaling protein
Keywords: signaling protein, signalling protein, ubiquitin
Deposited on 2015-01-19, released 2015-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Polyubiquitin-C
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96C32 (0-72)
    • engineered mutation (10)
  Domains in SCOPe 2.08: d5af5a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5af5A (A:)
  mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrl