PDB entry 4y5v

View 4y5v on RCSB PDB site
Description: Diabody 305 complex with EpoR
Class: protein binding/immune system
Keywords: diabody complex, receptor, protein binding-immune system complex
Deposited on 2015-02-12, released 2015-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diabody 305 VH domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5V
    Domains in SCOPe 2.07: d4y5va_
  • Chain 'B':
    Compound: Diabody 305 VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5V (0-End)
    Domains in SCOPe 2.07: d4y5vb_
  • Chain 'C':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered mutation (49)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d4y5vc1, d4y5vc2
  • Chain 'D':
    Compound: diabody 305 VH domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5V
    Domains in SCOPe 2.07: d4y5vd_
  • Chain 'E':
    Compound: Diabody 305 VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5V (0-End)
    Domains in SCOPe 2.07: d4y5ve_
  • Chain 'F':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered mutation (49)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d4y5vf1, d4y5vf2
  • Chain 'G':
    Compound: diabody 305 VH domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5V
    Domains in SCOPe 2.07: d4y5vg_
  • Chain 'H':
    Compound: Diabody 305 VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5V (0-End)
    Domains in SCOPe 2.07: d4y5vh_
  • Chain 'I':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered mutation (49)
    Domains in SCOPe 2.07: d4y5vi1, d4y5vi2
  • Heterogens: GOL, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y5vA (A:)
    hsafagsevqlvesggglvqpggslrlscaasgftfssywmswvrqapgkglewvanikp
    dgsekyyvdsvkgrftisrdnaknsvylqmnslraedtavyycarvsrggsysdwgqgtl
    vtvssggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5vA (A:)
    sevqlvesggglvqpggslrlscaasgftfssywmswvrqapgkglewvanikpdgseky
    yvdsvkgrftisrdnaknsvylqmnslraedtavyycarvsrggsysdwgqgtlvtvssg
    g
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y5vB (B:)
    sqsaltqpasvsgspgqsitisctgtssdvggyiyvswyqqhpgkapklmiydvsrrpsg
    isdrfsgsksgntasltisglqaedeadyycnsyttlstwlfgggtkvtvlaaaggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5vB (B:)
    sqsaltqpasvsgspgqsitisctgtssdvggyiyvswyqqhpgkapklmiydvsrrpsg
    isdrfsgsksgntasltisglqaedeadyycnsyttlstwlfgggtkvtvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y5vC (C:)
    fagsadpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqlede
    pwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlld
    apvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecv
    lsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdldkekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5vC (C:)
    pkfeskaallaargpeellcfterledlvcfweeapgqysfsyqledepwklcrlhqapt
    agavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarlades
    ghvvlrwlpppetpmtshiryevdvsagqgsvqrveilegrtecvlsnlrgrtrytfavr
    armaepsfggfwsawsepvslltpsd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y5vD (D:)
    hsafagsevqlvesggglvqpggslrlscaasgftfssywmswvrqapgkglewvanikp
    dgsekyyvdsvkgrftisrdnaknsvylqmnslraedtavyycarvsrggsysdwgqgtl
    vtvssggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5vD (D:)
    sevqlvesggglvqpggslrlscaasgftfssywmswvrqapgkglewvanikpdgseky
    yvdsvkgrftisrdnaknsvylqmnslraedtavyycarvsrggsysdwgqgtlvtvssg
    gg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4y5vE (E:)
    sqsaltqpasvsgspgqsitisctgtssdvggyiyvswyqqhpgkapklmiydvsrrpsg
    isdrfsgsksgntasltisglqaedeadyycnsyttlstwlfgggtkvtvlaaaggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5vE (E:)
    sqsaltqpasvsgspgqsitisctgtssdvggyiyvswyqqhpgkapklmiydvsrrpsg
    isdrfsgsksgntasltisglqaedeadyycnsyttlstwlfgggtkvtvla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4y5vF (F:)
    fagsadpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqlede
    pwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlld
    apvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecv
    lsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdldkekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5vF (F:)
    pkfeskaallaargpeellcfterledlvcfweeaapgqysfsyqledepwklcrlhqap
    targavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarlae
    sghvvlrwlpppetpmtshiryevdvsagqsvqrveilegrtecvlsnlrgrtrytfavr
    armaepsfggfwsawsepvslltpsd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4y5vG (G:)
    hsafagsevqlvesggglvqpggslrlscaasgftfssywmswvrqapgkglewvanikp
    dgsekyyvdsvkgrftisrdnaknsvylqmnslraedtavyycarvsrggsysdwgqgtl
    vtvssggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5vG (G:)
    sevqlvesggglvqpggslrlscaasgftfssywmswvrqapgkglewvanikpdgseky
    yvdsvkgrftisrdnaknsvylqmnslraedtavyycarvsrggsysdwgqgtlvtvss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4y5vH (H:)
    sqsaltqpasvsgspgqsitisctgtssdvggyiyvswyqqhpgkapklmiydvsrrpsg
    isdrfsgsksgntasltisglqaedeadyycnsyttlstwlfgggtkvtvlaaaggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5vH (H:)
    sqsaltqpasvsgspgqsitisctgtssdvggyiyvswyqqhpgkapklmiydvsrrpsg
    isdrfsgsksgntasltisglqaedeadyycnsyttlstwlfgggtkvtvla
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4y5vI (I:)
    fagsadpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqlede
    pwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlld
    apvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecv
    lsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdldkekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5vI (I:)
    kfeskaallaargpeellcfterledlvcfweeaapgqysfsyqledepwklcrlhqapt
    avrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarlsghvvl
    rwlpppetpmtshiryevdvsavqrveilegrtecvlsngrtrytfavrarmaepsfggf
    wsawsepvsll