PDB entry 4xua
View 4xua on RCSB PDB site
Description: Crystal Structure of the bromodomain of human BAZ2B in complex with E11919 BAZ2-ICR analogue
Class: transcription
Keywords: TRANSCRIPTION, bromodomain, acetylated lysine binding protein, KIAA1476, WALp4, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on
2015-01-25, released
2015-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated
2015-03-25, with a file datestamp of
2015-03-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2B
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2B, KIAA1476
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4xuaa1, d4xuaa2 - Heterogens: EDO, 43C, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4xuaA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
Sequence, based on observed residues (ATOM records): (download)
>4xuaA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv