PDB entry 4wmr

View 4wmr on RCSB PDB site
Description: STRUCTURE OF MCL1 BOUND TO BRD inhibitor ligand 1 AT 1.7A
Class: Apoptosis/Inhibitor
Keywords: Apoptosis, protein-protein interaction
Deposited on 2014-10-09, released 2015-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MCL1, BCL2L3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07820 (1-149)
      • expression tag (0)
    Domains in SCOPe 2.07: d4wmra1, d4wmra2
  • Heterogens: ZN, 865, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wmrA (A:)
selyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhv