PDB entry 4whu

View 4whu on RCSB PDB site
Description: BROMO domain of CREB binding protein
Class: transferase/transferase inhibitor
Keywords: bromo domain, creb binding protein, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-09-23, released 2015-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (2-118)
      • expression tag (0)
      • initiating methionine (1)
    Domains in SCOPe 2.05: d4whua_
  • Heterogens: 3OT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4whuA (A:)
smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg