PDB entry 4rvr

View 4rvr on RCSB PDB site
Description: Crystal Structure of the bromodomain of human BAZ2B in complex WITH GSK2801
Class: transcription
Keywords: SGC, Structural Genomics Consortium, TRANSCRIPTION, acetylated lysine binding protein, KIAA1476, WALp4, chemical probe
Deposited on 2014-11-27, released 2014-12-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-116)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4rvra_
  • Heterogens: 3WQ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rvrA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs