PDB entry 4qlf

View 4qlf on RCSB PDB site
Description: Crystal structure of I14G DHFR mutant complexed with folate and NADP+
Class: oxidoreductase
Keywords: dihydrofolate-reductase like fold/Alpha and beta proteins (a/b), oxidoreductase activity, NADP(H) binding, oxidoreductase
Deposited on 2014-06-12, released 2014-11-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.183
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:1403831]
    Gene: folA, BN896_0046
    Database cross-references and differences (RAF-indexed):
    • Uniprot U6N356 (0-158)
      • engineered mutation (13)
    Domains in SCOPe 2.05: d4qlfa_
  • Heterogens: FOL, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qlfA (A:)
    misliaalavdrvggmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qlfA (A:)
    misliaalavdrvggmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    ghfpdyepddwesvfsefhdadaqnshsycfeilerr