PDB entry 4ome

View 4ome on RCSB PDB site
Description: X-ray structure of human glutamate carboxypeptidase II in complex with DCCBL, a urea based inhibitor with distal carborane moiety
Class: Hydrolase/hydrolase inhibitor
Keywords: hydrolase, metallopeptidase, Hydrolase-hydrolase inhibitor complex
Deposited on 2014-01-27, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.159
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOLH, FOLH1, GIG27, NAALAD1, PSM, PSMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omea1, d4omea2, d4omea3
  • Heterogens: NAG, ZN, CA, CL, DGQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4omeA (A:)
    kssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkef
    gldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsa
    fspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagak
    gvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgi
    aeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvk
    mhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfg
    tlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlr
    vdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfev
    ffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggm
    vfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteia
    skfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyage
    sfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omeA (A:)
    khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
    vllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdl
    vyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpady
    fapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipv
    hpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtr
    iynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprr
    tilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslv
    hnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgr
    arytknwetfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpfd
    crdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfsnp
    ivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdiesk
    vdpskawgevkrqiyvaaftvqaaaetlseva