PDB entry 4nnl

View 4nnl on RCSB PDB site
Description: Tax-Interacting Protein-1 (TIP-1) PDZ domain bound to F-iCAL36 (ANSRFPTSII) peptide
Class: Protein Binding
Keywords: Tax-Interacting Protein-1, TIP-1, PDZ, PDZ-peptide, Protein Binding
Deposited on 2013-11-18, released 2015-01-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4nnla_
  • Chain 'B':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4nnlb_
  • Chain 'C':
    Compound: TIP-1 PDZ domain
    Database cross-references and differences (RAF-indexed):
    • PDB 4NNL (Start-9)
  • Chain 'D':
    Compound: TIP-1 PDZ domain
    Database cross-references and differences (RAF-indexed):
    • PDB 4NNL (0-9)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4nnlA (A:)
tavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeia
glqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4nnlB (B:)
tavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeia
glqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq

    Sequence, based on observed residues (ATOM records): (download) 
    >4nnlB (B:)
avvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeiag
lqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.