PDB entry 4m1q

View 4m1q on RCSB PDB site
Description: Crystal structure of L-lactate dehydrogenase from Bacillus selenitireducens MLS10, NYSGRC Target 029814.
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, L-lactate dehydrogenase, NYSGRC, PSI-Biology, New York Structural Genomics Research Consortium, OXIDOREDUCTASE
Deposited on 2013-08-03, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Bacillus selenitireducens [TaxId:439292]
    Gene: ldh, Bsel_2311
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m1qa1, d4m1qa2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Bacillus selenitireducens [TaxId:439292]
    Gene: ldh, Bsel_2311
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m1qb1, d4m1qb2
  • Heterogens: PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m1qA (A:)
    mhhhhhhssgvdlgtenlyfqsmntktsrvviigtgavgssyafsminqnvtdemvlidl
    dkrktegdamdlnhgipfgaptkvwagdygdcksadivvitagaaqkpgetrldlvekna
    nifkgivdqvmgsgfngifiiatnpvdvlayatwkfsglpkervigsgtildtarfrfll
    seyfdidvrnihgyimgehgdtelpvwsqtrigsepisrymdkykpdgsnkdldeifvnv
    rdaayhiierkgathyaiamglarltkailrneqsiltvstlmegeydlddvyigvpaiv
    sqkgveraieidlndeemkklhhssntlkdvmkpifdmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m1qA (A:)
    tktsrvviigtgavgssyafsminqnvtdemvlidldkrktegdamdlnhgipfgaptkv
    wagdygdcksadivvitagaaqkpgetrldlveknanifkgivdqvmgsgfngifiiatn
    pvdvlayatwkfsglpkervigsgtildtarfrfllseyfdidvrnihgyimgehgdtel
    pvwsqtrigsepisrymdkykpdgsnkdldeifvnvrdaayhiierkgathyaiamglar
    ltkailrneqsiltvstlmegeydlddvyigvpaivsqkgveraieidlndeemkklhhs
    sntlkdvmkpif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m1qB (B:)
    mhhhhhhssgvdlgtenlyfqsmntktsrvviigtgavgssyafsminqnvtdemvlidl
    dkrktegdamdlnhgipfgaptkvwagdygdcksadivvitagaaqkpgetrldlvekna
    nifkgivdqvmgsgfngifiiatnpvdvlayatwkfsglpkervigsgtildtarfrfll
    seyfdidvrnihgyimgehgdtelpvwsqtrigsepisrymdkykpdgsnkdldeifvnv
    rdaayhiierkgathyaiamglarltkailrneqsiltvstlmegeydlddvyigvpaiv
    sqkgveraieidlndeemkklhhssntlkdvmkpifdmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m1qB (B:)
    ktsrvviigtgavgssyafsminqnvtdemvlidldkrktegdamdlnhgipfgaptkvw
    agdygdcksadivvitagaagetrldlveknanifkgivdqvmgsgfngifiiatnpvdv
    layatwkfsglpkervigsgtildtarfrfllseyfdidvrnihgyimgehgdtelpvws
    qtrigsepisrymdkykpdgsnkdldeifvnvrdaayhiierkgathyaiamglarltka
    ilrneqsiltvstlmegeydlddvyigvpaivsqkgveraieidlndeemkklhhssntl
    kdvmkpifd