PDB entry 4lhv

View 4lhv on RCSB PDB site
Description: Crystal structure of Rab8 in its inactive GDP-bound form
Class: protein transport
Keywords: Small GTPase, PROTEIN TRANSPORT
Deposited on 2013-07-01, released 2013-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab8a, Mel, Rab8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61006 (3-173)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4lhva1, d4lhva2
  • Chain 'B':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab8a, Mel, Rab8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61006 (3-173)
      • expression tag (2)
    Domains in SCOPe 2.07: d4lhvb1, d4lhvb2
  • Chain 'C':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab8a, Mel, Rab8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lhvc_
  • Chain 'D':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab8a, Mel, Rab8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lhvd_
  • Chain 'E':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab8a, Mel, Rab8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61006 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d4lhve1, d4lhve2
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lhvA (A:)
    gshdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhvA (A:)
    gshdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtttayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvndkrqv
    skergeklaldygikfmetsakaninvenafftlardikakmdkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lhvB (B:)
    gshdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhvB (B:)
    hdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdt
    ayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvndkrqvsker
    geklaldygikfmetsakaninvenafftlardikakmdkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lhvC (C:)
    gshdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhvC (C:)
    dylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdta
    yyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvndkrqvskerg
    eklaldygikfmetsakaninvenafftlardikakmdkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lhvD (D:)
    gshdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhvD (D:)
    dylfkllligdsgvgktcvlfrfsedafnstfistidfkirtieldgkriklqiwdtayy
    rgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvndkrqvskergek
    laldygikfmetsakaninvenafftlardikakmdkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4lhvE (E:)
    gshdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhvE (E:)
    hdylfkllligdsgvgktcvlfrfsedadfkirtieldgkriklqiwdtayyrgamgiml
    vyditneksfdnirnwirnieehasadvekmilgnkcdvndkrqvskergeklaldygik
    fmetsakaninvenafftlardikakmd