PDB entry 4kwn

View 4kwn on RCSB PDB site
Description: A new stabilizing water structure at the substrate binding site in ribosome inactivating protein from Momordica balsamina at 1.80 A resolution
Class: hydrolase
Keywords: Ribosome inactivating protein, Hydrolase
Deposited on 2013-05-24, released 2013-06-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rRNA N-glycosidase
  Species: Momordica balsamina [TaxId:3672]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D9J2T9 (0-245)
  Domains in SCOPe 2.02: d4kwna_
• Heterogens: NAG, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4kwnA (A:)
  dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
  tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
  prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
  pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
  lntkni