PDB entry 4jhp

View 4jhp on RCSB PDB site
Description: The crystal structure of the RPGR RCC1-like domain in complex with PDE6D
Class: lipid binding protein
Keywords: immunoglobulin-like beta-sandwich, RCC1-like domain, beta propellar, seven bladed-propeller, STRUCTURAL PROTEIN, LIPID BINDING PROTEIN
Deposited on 2013-03-05, released 2013-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE6D, PDED
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jhpb_
  • Chain 'C':
    Compound: X-linked retinitis pigmentosa GTPase regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: RPGR, RP3, XLRP3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4jhpB (B:)
gsmsakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkcka
vsrelnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmm
pasvltgnviietkffdddllvstsrvrlfyv

    Sequence, based on observed residues (ATOM records): (download) 
    >4jhpB (B:)
kderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsrel
nfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieammpasvltgnvi
ietkffdddllvstsrvrlfyv

  • Chain 'C':
    No sequence available.