PDB entry 4jh4

View 4jh4 on RCSB PDB site
Description: Crystal Structure of FosB from Bacillus cereus with Nickel and Fosfomycin
Class: Transferase
Keywords: Bacillithiol-S-Transferase, Transferase
Deposited on 2013-03-04, released 2013-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallothiol transferase FosB
    Species: Bacillus cereus [TaxId:222523]
    Gene: fosB, BCE_2111
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jh4a_
  • Chain 'B':
    Compound: Metallothiol transferase FosB
    Species: Bacillus cereus [TaxId:222523]
    Gene: fosB, BCE_2111
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jh4b_
  • Heterogens: NI, FCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4jh4A (A:)
mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
lqdrlnyyredkphmtfy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4jh4B (B:)
mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
lqdrlnyyredkphmtfy