PDB entry 4icb

View 4icb on RCSB PDB site
Description: proline cis-trans isomers in calbindin d9k observed by x-ray crystallography
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1991-08-27, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calbindin d9k
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02633 (1-75)
  Domains in SCOPe 2.06: d4icba_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4icbA (A:)
  mkspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdg
  evsfeefqvlvkkisq