PDB entry 4i9o

View 4i9o on RCSB PDB site
Description: Crystal Structure of GACKIX L664C Tethered to 1-10
Class: transferase
Keywords: KIX domain, Transcriptional Coactivator, TRANSFERASE
Deposited on 2012-12-05, released 2013-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45481
      • engineered mutation (92)
    Domains in SCOPe 2.08: d4i9oa_
  • Heterogens: KI1, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4i9oA (A:)
mrgshhhhhhgmasgvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvay
akkvegdmyesansrdeyyhllaekiykiqkeceekrrsrl

    Sequence, based on observed residues (ATOM records): (download) 
    >4i9oA (A:)
rkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrd
eyyhllaekiykiqkece