PDB entry 4hy0

View 4hy0 on RCSB PDB site
Description: Crystal structure of XIAP BIR3 with T3256336
Class: ligase
Keywords: BIR3, Baculoviral IAP repeat-containing protein 4, Apoptotic suppressor. Inhibitor of caspase-3, -7 and -9., Interacts with SMAC and with PRSS25, XIAP, BIRC4, X-linked inhibitor of apoptosis, LIGASE
Deposited on 2012-11-12, released 2013-01-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: 0.211
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: API3, BIRC4, IAP3, XIAP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170
  Domains in SCOPe 2.02: d4hy0a_
• Chain 'B':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: API3, BIRC4, IAP3, XIAP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170
• Chain 'C':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: API3, BIRC4, IAP3, XIAP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170
• Chain 'D':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: API3, BIRC4, IAP3, XIAP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170
• Chain 'E':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: API3, BIRC4, IAP3, XIAP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170
• Chain 'F':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: API3, BIRC4, IAP3, XIAP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170
• Chain 'G':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: API3, BIRC4, IAP3, XIAP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170
• Chain 'H':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: API3, BIRC4, IAP3, XIAP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170
• Heterogens: ZN, 1AQ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4hy0A (A:)
  gplgsrsesdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyal
  gegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleecl
  vrtte
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4hy0A (A:)
  tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
  edpweqhakwypgckylleqkgqeyinnihlthsle
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.