PDB entry 4hv3

View 4hv3 on RCSB PDB site
Description: Structure of Ricin A chain bound with N-(N-(pterin-7-yl)carbonyl-L-serinyl)-L-tryptophan
Class: hydrolase/hydrolase inhibitor
Keywords: ricin,protein-ligand complex, pterin, hydrolase-hydrolase inhibitor complex, toxin, hydrolase, ribosome-inactivating protein, n-glycosidase
Deposited on 2012-11-05, released 2012-12-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ricin
  Species: Ricinus communis [TaxId:3988]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02879 (1-267)
    • expression tag (0)
  Domains in SCOPe 2.06: d4hv3a1, d4hv3a2
• Heterogens: 19L, SO4, MLA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hv3A (A:)
  mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
  velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
  ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
  rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
  fsvydvsilipiialmvyrcapppssqf