PDB entry 4ht1

View 4ht1 on RCSB PDB site
Description: Human TWEAK in complex with the Fab fragment of a neutralizing antibody
Class: immune system
Keywords: antibody Fab, TNF homology domain, cytokine, Tweak receptor, membrane bound, extracellular THD domain, IMMUNE SYSTEM
Deposited on 2012-10-31, released 2013-06-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric antibody Fab
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HT1 (0-End)
  • Chain 'L':
    Compound: chimeric antibody Fab
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HT1 (0-End)
    Domains in SCOPe 2.05: d4ht1l1, d4ht1l2
  • Chain 'T':
    Compound: Tumor necrosis factor ligand superfamily member 12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4ht1L (L:)
    aiemtqtpfsvsaavggtvtincqasqniysnlawyqqkpgqppkllmytasylasgvps
    rfkgsgsrteytltisgvqcadaatyycqtayynsrpdtvafgggtevvvkrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ht1L (L:)
    aiemtqtpfsvsaavggtvtincqasqniysnlawyqqkpgqppkllmytasylasgvps
    rfkgsgsrteytltisgvqcadaatyycqtayynsrpdtvafgggtevvvkrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'T':
    No sequence available.