PDB entry 4hpw

View 4hpw on RCSB PDB site
Description: Crystal structure of Tyrosine-tRNA ligase mutant complexed with unnatural amino acid 3-o-methyl-Tyrosine
Class: ligase
Keywords: 3-o-methyl tyrosine incorporation, tRNA, LIGASE
Deposited on 2012-10-24, released 2013-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine--tRNA ligase
  Species: Methanocaldococcus jannaschii [TaxId:243232]
  Gene: tyrS, MJ0389
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57834 (0-305)
    • engineered mutation (31)
    • engineered mutation (64)
    • engineered mutation (69)
    • engineered mutation (108)
    • engineered mutation (157)
    • engineered mutation (161)
    • expression tag (306-309)
  Domains in SCOPe 2.06: d4hpwa1, d4hpwa2
• Heterogens: 3YM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hpwA (A:)
  mdefemikrntseiiseeelrevlkkdeksaeigfepsgkihlghylqikkmidlqnagf
  diiisladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsefgldkdytlnvyr
  lalkttlkrarrsmeliaredenpkvaeviypimqvnnihyvgvdvavggmeqrkihmla
  rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
  imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
  pirkrlaahh