PDB entry 4hko

View 4hko on RCSB PDB site
Description: Crystal Structures of Mutant Endo-beta-1,4-xylanase II (E177Q) in the apo form
Class: hydrolase
Keywords: xylanase II, xylohexaose, xylotriose, induced fit mechanism, oxocarbenium ion, HYDROLASE
Deposited on 2012-10-15, released 2014-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Endo-1,4-beta-xylanase 2
  Species: TRICHODERMA REESEI [TaxId:51453]
  Gene: xyn2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36217 (0-188)
    • engineered mutation (175)
  Domains in SCOPe 2.08: d4hkoa_
• Heterogens: IOD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hkoA (A:)
  tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
  fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
  rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavqgyfs
  sgsasitvs