SCOPe 2.05: Structural Classification of Proteins

PDB entry 4gyv

View 4gyv on RCSB PDB site
Description: Crystal strucure of the DH domain of FARP2
Class: signaling protein
Keywords: FARP2, DH, GEF, guanine nucleotide exchange factor, SIGNALING PROTEIN
Deposited on 2012-09-05, released 2013-03-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.179
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Farp2, Kiaa0793
Database cross-references and differences (RAF-indexed):
- Uniprot Q91VS8 (4-End)
  - expression tag (0-3)
Domains in SCOPe 2.05: d4gyva_
Chain 'B':
Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Farp2, Kiaa0793
Database cross-references and differences (RAF-indexed):
- Uniprot Q91VS8 (4-End)
  - expression tag (0-3)
Domains in SCOPe 2.05: d4gyvb_
Chain 'C':
Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Farp2, Kiaa0793
Database cross-references and differences (RAF-indexed):
- Uniprot Q91VS8 (4-End)
  - expression tag (0-3)
Domains in SCOPe 2.05: d4gyvc_
Chain 'D':
Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Farp2, Kiaa0793
Database cross-references and differences (RAF-indexed):
- Uniprot Q91VS8 (4-End)
  - expression tag (0-3)
Domains in SCOPe 2.05: d4gyvd_
Chain 'E':
Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Farp2, Kiaa0793
Database cross-references and differences (RAF-indexed):
- Uniprot Q91VS8 (4-End)
  - expression tag (0-3)
Domains in SCOPe 2.05: d4gyve_
Chain 'F':
Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Farp2, Kiaa0793
Database cross-references and differences (RAF-indexed):
- Uniprot Q91VS8 (4-End)
  - expression tag (0-3)
Domains in SCOPe 2.05: d4gyvf_
Chain 'G':
Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Farp2, Kiaa0793
Database cross-references and differences (RAF-indexed):
- Uniprot Q91VS8 (4-End)
  - expression tag (0-3)
Domains in SCOPe 2.05: d4gyvg_
Chain 'H':
Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Farp2, Kiaa0793
Database cross-references and differences (RAF-indexed):
- Uniprot Q91VS8 (4-End)
  - expression tag (0-3)
Domains in SCOPe 2.05: d4gyvh_
Chain 'I':
Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Farp2, Kiaa0793
Database cross-references and differences (RAF-indexed):
- Uniprot Q91VS8 (4-End)
  - expression tag (0-3)
Domains in SCOPe 2.05: d4gyvi_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4gyvA (A:)
gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
chealkaitevttelqqsltrlenlqkltelqrdlvgv