PDB entry 4gh8

View 4gh8 on RCSB PDB site
Description: Crystal structure of a 'humanized' E. coli dihydrofolate reductase
Class: oxidoreductase
Keywords: tetrahydrofolate, enzyme catalysis, evolution, Dihydrofolate reductase, OXIDOREDUCTASE
Deposited on 2012-08-07, released 2013-06-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.205
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Escherichia coli [TaxId:83333]
  Gene: folA, tmrA, b0048, JW0047
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABQ4 (0-161)
    • see remark 999 (22-23)
    • see remark 999 (51-54)
  Domains in SCOPe 2.05: d4gh8a_
• Chain 'B':
  Compound: dihydrofolate reductase
  Species: Escherichia coli [TaxId:83333]
  Gene: folA, tmrA, b0048, JW0047
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABQ4 (0-161)
    • see remark 999 (22-23)
    • see remark 999 (51-54)
  Domains in SCOPe 2.05: d4gh8b_
• Heterogens: MTX, NDP, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4gh8A (A:)
  misliaalavdrvigmenampwpplpadlawfkrntlnkpvimgrhtwesipeknrplpg
  rkniilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthid
  aevegdthfpdyepddwesvfsefhdadaqnshsycfeiler
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4gh8B (B:)
  misliaalavdrvigmenampwpplpadlawfkrntlnkpvimgrhtwesipeknrplpg
  rkniilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthid
  aevegdthfpdyepddwesvfsefhdadaqnshsycfeiler