PDB entry 4fu0

View 4fu0 on RCSB PDB site
Description: Crystal Structure of VanG D-Ala:D-Ser Ligase from Enterococcus faecalis
Class: ligase
Keywords: Vancomycin resistance, Peptidoglycan synthesis, D-Ala:D-Ser ligase, ATP-grasp domain, LIGASE
Deposited on 2012-06-28, released 2012-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-alanine--D-alanine ligase 7
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: ddl7, vanG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fu0a1, d4fu0a2
  • Chain 'B':
    Compound: D-alanine--D-alanine ligase 7
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: ddl7, vanG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fu0b1, d4fu0b2
  • Heterogens: ADP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fu0A (A:)
    mqnkkiavifggnsteyevslqsasavfenintnkfdiipigitrsgewyhytgekekil
    nntwfedsknlcpvvvsqnrsvkgfleiasdkyriikvdlvfpvlhgkngedgtlqgife
    lagipvvgcdtlssalcmdkdrahklvslagisvpksvtfkrfneeaamkeieanltypl
    fikpvragssfgitkviekqeldaaielafehdteviveetingfevgcavlgidelivg
    rvdeielssgffdytekytlksskiymparidaeaekriqeaavtiykalgcsgfsrvdm
    fytpsgeivfnevntipgftshsrypnmmkgiglsfsqmldkliglyvelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fu0A (A:)
    qnkkiavifggnsteyevslqsasavfenintnkfdiipigitrsgewyhytgekekiln
    ntwfedsknlcpvvvsqnrsvkgfleiyriikvdlvfpvlhgkngedgtlqgifelagip
    vvgcdtlssalcmdkdrahklvslagisvpksvtfkrfneeaamkeieanltyplfikpv
    ragssfgitkviekqeldaaielafehdteviveetingfevgcavlgidelivgrvdei
    elssgffdytekytlksskiymparidaeaekriqeaavtiykalgcsgfsrvdmfytps
    geivfnevntipgftshsrypnmmkgiglsfsqmldkliglyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fu0B (B:)
    mqnkkiavifggnsteyevslqsasavfenintnkfdiipigitrsgewyhytgekekil
    nntwfedsknlcpvvvsqnrsvkgfleiasdkyriikvdlvfpvlhgkngedgtlqgife
    lagipvvgcdtlssalcmdkdrahklvslagisvpksvtfkrfneeaamkeieanltypl
    fikpvragssfgitkviekqeldaaielafehdteviveetingfevgcavlgidelivg
    rvdeielssgffdytekytlksskiymparidaeaekriqeaavtiykalgcsgfsrvdm
    fytpsgeivfnevntipgftshsrypnmmkgiglsfsqmldkliglyvelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fu0B (B:)
    qnkkiavifggnsteyevslqsasavfenintnkfdiipigitrsgewyhytgekekiln
    ntwfedsknlcpvvvsqnrsvkgfleiyriikvdlvfpvlhgkngedgtlqgifelagip
    vvgcdtlssalcmdkdrahklvslagisvpksvtfkrfneeaamkeieanltyplfikpv
    ragssfgitkviekqeldaaielafehdteviveetingfevgcavlgidelivgrvdei
    elssgffdytekytlksskiymparidaeaekriqeaavtiykalgcsgfsrvdmfytps
    geivfnevntipgftshsrypnmmkgiglsfsqmldkliglyv