PDB entry 4fiw

View 4fiw on RCSB PDB site
Description: X-ray crystal structure of Corynebacterium glutamicum Nrdh-redoxin at 1.5A
Class: oxidoreductase
Keywords: Thioredoxin fold, OXIDOREDUCTASE
Deposited on 2012-06-11, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.193
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative glutaredoxin NrdH
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: nrdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fiwa_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4fiwA (A:)
maitvytkpacvqcnatkkaldragleydlvdisldeeareyvlalgylqapvvvadgsh
wsgfrperiremataaa

    Sequence, based on observed residues (ATOM records): (download) 
    >4fiwA (A:)
aitvytkpacvqcnatkkaldragleydlvdisldeeareyvlalgylqapvvvadgshw
sgfrperiremataaa