PDB entry 4ffy
View 4ffy on RCSB PDB site
Description: Crystal structure of DENV1-E111 single chain variable fragment bound to DENV-1 DIII, strain 16007.
Class: immune system/viral protein
Keywords: Viral envelope proteins, structural genomics, antibody epitopes, Flavivirus, Dengue virus, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, IMMUNE SYSTEM, IMMUNE SYSTEM-VIRAL PROTEIN complex
Deposited on
2012-06-01, released
2012-06-20
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-10-31, with a file datestamp of
2012-10-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Envelope glycoprotein
Species: Dengue virus 1 [TaxId:11053]
Gene: Envelope domain III
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d4ffya_ - Chain 'H':
Compound: DENV1-E111 single chain variable fragment (heavy chain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: DENV1-E111 single chain variable fragment (light chain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Heterogens: GOL, CL, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4ffyA (A:)
masmtlkgmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqn
grlitanpivtdkekpvnieaeppfgesyivvgagekalklswfkkgssig
Sequence, based on observed residues (ATOM records): (download)
>4ffyA (A:)
yvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitanpiv
tdkekpvnieaeppfgesyivvgagekalklswfkkg
- Chain 'H':
No sequence available.
- Chain 'L':
No sequence available.