PDB entry 4ffy

View 4ffy on RCSB PDB site
Description: Crystal structure of DENV1-E111 single chain variable fragment bound to DENV-1 DIII, strain 16007.
Class: immune system/viral protein
Keywords: Viral envelope proteins, structural genomics, antibody epitopes, Flavivirus, Dengue virus, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, IMMUNE SYSTEM, IMMUNE SYSTEM-VIRAL PROTEIN complex
Deposited on 2012-06-01, released 2012-06-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein
    Species: Dengue virus 1 [TaxId:11053]
    Gene: Envelope domain III
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4ffya_
  • Chain 'H':
    Compound: DENV1-E111 single chain variable fragment (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FFY (0-End)
  • Chain 'L':
    Compound: DENV1-E111 single chain variable fragment (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FFY (0-End)
  • Heterogens: GOL, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ffyA (A:)
    masmtlkgmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqn
    grlitanpivtdkekpvnieaeppfgesyivvgagekalklswfkkgssig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ffyA (A:)
    yvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitanpiv
    tdkekpvnieaeppfgesyivvgagekalklswfkkg
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.