PDB entry 4f2o

View 4f2o on RCSB PDB site
Description: Quisqualate bound to the D655A mutant of the ligand binding domain of GluA3
Class: transport protein/agonist
Keywords: glutamate receptor, GluA3, GluR3, AMPA receptor, S1S2, LBD, neurotransmitter receptor, quisqualate, TRANSPORT PROTEIN-AGONIST complex
Deposited on 2012-05-08, released 2012-05-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Glur3, Gria3, Gria3; GluA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19492 (0-113)
      • linker (114-115)
    • Uniprot P19492 (116-257)
      • engineered mutation (135)
    Domains in SCOPe 2.05: d4f2oa_
  • Heterogens: QUS, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4f2oA (A:)
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtlasgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgnavnlavlklne
qglldklknkwwydkgec