PDB entry 4dp6

View 4dp6 on RCSB PDB site
Description: The 1.67 Angstrom crystal structure of reduced (CuI) poplar plastocyanin B at pH 8.0
Class: electron transport
Keywords: membrane, thylakoid, transit peptide, plastocyanin-like domain, copper-binding, ELECTRON TRANSPORT
Deposited on 2012-02-13, released 2013-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.177
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Plastocyanin B, chloroplastic
  Species: Populus nigra [TaxId:3691]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11970 (0-98)
  Domains in SCOPe 2.06: d4dp6x_
• Heterogens: CU1, GOL, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4dp6X (X:)
  vdvllgaddgslafvpsefsvpagekivfknnagfphnvlfdedavpsgvdvskismsee
  dllnakgetfevalsdkgeytfycsphqgagmvgkvivn