PDB entry 4dgz

View 4dgz on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS I92A/L125A at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, pdtp, cavity, pressure, HYDROLASE
Deposited on 2012-01-27, released 2012-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.177
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (43-44)
      • engineered mutation (85)
      • engineered mutation (110)
      • engineered mutation (117-118)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d4dgza_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dgzA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayayadgkmvnealvrqglakvayvykgnntheqlar
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dgzA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayayadgkmvnealvrqglakvayvykgnntheqlarkaeaqa
    kkeklniws