PDB entry 4buq

View 4buq on RCSB PDB site
Description: Crystal structure of wild type FimH lectin domain in complex with heptyl alpha-D-mannopyrannoside
Class: cell adhesion
Keywords: cell adhesion, type 1 fimbriae, urinary tract infection, variable immunoglobulin fold
Deposited on 2013-06-23, released 2014-02-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2047
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH
    Species: Escherichia coli UTI89 [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4buqa_
  • Chain 'B':
    Compound: FimH
    Species: Escherichia coli UTI89 [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4buqb_
  • Heterogens: KGM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4buqA (A:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4buqB (B:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt