PDB entry 4aig

View 4aig on RCSB PDB site
Description: adamalysin II with phosphonate inhibitor
Class: metalloendopeptidase
Keywords: snake venom metalloendopeptidase, zinc protease
Deposited on 1997-10-16, released 1998-11-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adamalysin II
    Species: Crotalus adamanteus [TaxId:8729]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4aiga_
  • Heterogens: ZN, CA, FLX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4aigA (A:)
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp