PDB entry 4a14

View 4a14 on RCSB PDB site
Description: human kif7, a kinesin involved in hedgehog signalling
Class: motor protein
Keywords: motor protein, kinesin, motor domain
Deposited on 2011-09-14, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1837
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin-like protein kif7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a14a_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a14A (A:)
    gamglpgaeeapvrvalrvrpllpkellhghqsclqvepglgrvtlgrdrhfgfhvvlae
    dagqeavyqacvqplleaffegfnatvfaygqtgsgktytmgeasvaslledeqgivpra
    maeafklidendlldclvhvsylevykeefrdllevgtasrdiqlredergnvvlcgvke
    vdvegldevlsllemgnaarhtgathlnhlssrshtvftvtleqrgrapsrlprpapgql
    lvskfhfvdlagservlktgstgerlkesiqinssllalgnvisalgdpqrrgshipyrd
    skitrilkdslggnaktvmiacvspsssdfdetlntlnyasraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a14A (A:)
    eeapvrvalrvrpllpkellhghqsclqvepglgrvtlgrdrhfgfhvvlaedagqeavy
    qacvqplleaffegfnatvfaygqtgsgktytmgedeqgivpramaeafklidendlldc
    lvhvsylevykeefrdllevgtasrdiqlredergnvvlcgvkevdvegldevlsllemg
    naarhthlssrshtvftvtleqrgqllvskfhfvdlagservqinssllalgnvisalgd
    pqrrgshipyrdskitrilkdslggnaktvmiacvspsssdfdetlntlnyasraq