PDB entry 3ve3

View 3ve3 on RCSB PDB site
Description: Structure of IT Intermediate from time-resolved laue crystallography
Class: luminescent protein
Keywords: photoreceptor, chromophore, sensory transduction, luminescent protein
Deposited on 2012-01-07, released 2013-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Halorhodospira halophila [TaxId:1053]
  Gene: PYP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOPe 2.08: d3ve3a_
• Heterogens: HC4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ve3A (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv