PDB entry 3uzv

View 3uzv on RCSB PDB site
Description: Crystal structure of the dengue virus serotype 2 envelope protein domain III in complex with the variable domains of Mab 4E11
Class: immune system
Keywords: dengue antibody neutralization, IMMUNE SYSTEM
Deposited on 2011-12-07, released 2012-02-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Dengue virus 2 [TaxId:11064]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07564 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.02: d3uzva_
  • Chain 'B':
    Compound: anti-dengue Mab 4E11
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UZV
  • Heterogens: EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uzvA (A:)
    mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitv
    npivtekdspvnieaeppfgdsyiiigvepgqlklnwfkkgssigqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzvA (A:)
    mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlhvlgrlitvnpi
    vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'B':
    No sequence available.