PDB entry 3uzv
View 3uzv on RCSB PDB site
Description: Crystal structure of the dengue virus serotype 2 envelope protein domain III in complex with the variable domains of Mab 4E11
Class: immune system
Keywords: dengue antibody neutralization, IMMUNE SYSTEM
Deposited on
2011-12-07, released
2012-02-22
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-04-18, with a file datestamp of
2012-04-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: envelope protein
Species: Dengue virus 2 [TaxId:11064]
Database cross-references and differences (RAF-indexed):
- Uniprot P07564 (1-End)
- initiating methionine (0)
Domains in SCOPe 2.02: d3uzva_ - Chain 'B':
Compound: anti-dengue Mab 4E11
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Heterogens: EOH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3uzvA (A:)
mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitv
npivtekdspvnieaeppfgdsyiiigvepgqlklnwfkkgssigqlehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3uzvA (A:)
mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
- Chain 'B':
No sequence available.