PDB entry 3uwt

View 3uwt on RCSB PDB site
Description: Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 2.50 A resolution
Class: RNA binding protein
Keywords: RNA recognition motive, RRM, RNA binding domain, splicing, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, RNA BINDING PROTEIN, Partnership for T-Cell Biology
Deposited on 2011-12-02, released 2012-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(U)-binding-splicing factor PUF60
    Species: Homo sapiens [TaxId:9606]
    Gene: BC008875, FIR, PUF60, ROBPI, SIAHBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHX1 (1-End)
      • leader sequence (0)
    Domains in SCOPe 2.06: d3uwta1, d3uwta2, d3uwta3
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uwtA (A:)
    gaaqrqralaimcrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfafve
    yevpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidqlaeearafnriyvasvhqd
    lsdddiksvfeafgkiksctlardpttgkhkgygfieyekaqssqdavssmnlfdlggqy
    lrvgkavtppmplltpatpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uwtA (A:)
    gaaqrqralaimcrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfafve
    yevpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidqlaeearafnriyvasvhqd
    lsdddiksvfeafgkiksctlardpttgkhkgygfieyekaqssqdavssmnlfdlggqy
    lrvgkavtppmplltpa