PDB entry 3upj

View 3upj on RCSB PDB site
Description: human immunodeficiency virus type 2 protease mutant with lys 57 replaced by leu (k57l) complex with u096333 [4-hydroxy-3-[1-(phenyl)propyl]-7-methoxycoumarin]
Class: hydrolase (acid protease)
Keywords: hydrolase (acid protease)
Deposited on 1996-03-04, released 1996-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-2 protease
    Species: Human immunodeficiency virus 2 [TaxId:11709]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04584 (0-98)
      • engineered (56)
    Domains in SCOPe 2.05: d3upja_
  • Chain 'B':
    Compound: hiv-2 protease
    Species: Human immunodeficiency virus 2 [TaxId:11709]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04584 (Start-98)
      • engineered (56)
    Domains in SCOPe 2.05: d3upjb_
  • Heterogens: U03, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3upjA (A:)
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3upjB (B:)
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

    Sequence, based on observed residues (ATOM records): (download) 
    >3upjB (B:)
fslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyknv
eievlnkkvratimtgdtpinifgrniltalgmslnl