PDB entry 3ueg

View 3ueg on RCSB PDB site
Description: Crystal structure of human Survivin K62A mutant
Class: cell cycle
Keywords: zinc finger, BIR domain, chromosomal passenger complex, cell division, mitosis, CELL CYCLE
Deposited on 2011-10-30, released 2012-03-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: API4, BIRC5, IAP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15392
      • engineered mutation (65)
      • see remark 999 (132)
    Domains in SCOPe 2.02: d3uega_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: API4, BIRC5, IAP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15392 (Start-145)
      • engineered mutation (65)
      • see remark 999 (132)
  • Heterogens: ZN, EDO, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uegA (A:)
    gshemgaptlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaq
    cffcfaelegwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiake
    tnnkkkefeetakkvrraieqlaamd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uegA (A:)
    tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfael
    egwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkef
    eetakkvrraieqlaam
    

  • Chain 'B':
    No sequence available.