PDB entry 3ueg
View 3ueg on RCSB PDB site
Description: Crystal structure of human Survivin K62A mutant
Class: cell cycle
Keywords: zinc finger, BIR domain, chromosomal passenger complex, cell division, mitosis, CELL CYCLE
Deposited on
2011-10-30, released
2012-03-07
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-07-25, with a file datestamp of
2012-07-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.194
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Baculoviral IAP repeat-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: API4, BIRC5, IAP4
Database cross-references and differences (RAF-indexed):
- Uniprot O15392
- engineered mutation (65)
- see remark 999 (132)
Domains in SCOPe 2.02: d3uega_ - Chain 'B':
Compound: Baculoviral IAP repeat-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: API4, BIRC5, IAP4
Database cross-references and differences (RAF-indexed):
- Uniprot O15392 (Start-145)
- engineered mutation (65)
- see remark 999 (132)
- Heterogens: ZN, EDO, PG4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3uegA (A:)
gshemgaptlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaq
cffcfaelegwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiake
tnnkkkefeetakkvrraieqlaamd
Sequence, based on observed residues (ATOM records): (download)
>3uegA (A:)
tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfael
egwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkef
eetakkvrraieqlaam
- Chain 'B':
No sequence available.