PDB entry 3tvr

View 3tvr on RCSB PDB site
Description: Crystal Structure of Streptomyces coelicolor Polyketide Aromatase/Cyclase whiE-ORFVI
Class: unknown function
Keywords: Helix-grip fold, polyketide aromatase/cyclase, polyketide binding, UNKNOWN FUNCTION
Deposited on 2011-09-20, released 2012-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyketide cyclase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SC6G9.18, SCO5315, whiE ORFVI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23154 (14-172)
      • expression tag (0-11)
      • expression tag (13)
    Domains in SCOPe 2.05: d3tvra_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3tvrA (A:)
hhhhssglvprgshmaghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrddd
kvtfrltmhpdadgkvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvm
rwtqdfamkpdapvddawmtdninrnsrtqmalirdrieqaagerrtasvlad

    Sequence, based on observed residues (ATOM records): (download) 
    >3tvrA (A:)
hhhhssglvprghmaghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddk
vtfrltmhpdadgkvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmr
wtqdfamkpdapvddawmtdninrnsrtqmalirdrieqaagerrtasvlad