PDB entry 3t89

View 3t89 on RCSB PDB site
Description: Crystal structure of Escherichia coli MenB, the 1,4-dihydroxy-2-naphthoyl-CoA synthase in vitamin K2 biosynthesis
Class: lyase
Keywords: crotonase superfamily, LYASE
Deposited on 2011-08-01, released 2011-08-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.187
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
  Species: Escherichia coli [TaxId:562]
  Gene: b2262
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABU0 (4-288)
• Chain 'B':
  Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
  Species: Escherichia coli [TaxId:562]
  Gene: b2262
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABU0 (Start-288)
• Chain 'C':
  Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
  Species: Escherichia coli [TaxId:562]
  Gene: b2262
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABU0
• Chain 'D':
  Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
  Species: Escherichia coli [TaxId:562]
  Gene: b2262
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABU0 (Start-288)
• Chain 'E':
  Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
  Species: Escherichia coli [TaxId:562]
  Gene: b2262
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABU0 (Start-288)
• Chain 'F':
  Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
  Species: Escherichia coli [TaxId:562]
  Gene: b2262
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABU0 (Start-288)
  Domains in SCOPe 2.02: d3t89f_
• Heterogens: MLI, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >3t89F (F:)
  gshmmiypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkem
  iqaladaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqir
  tcpkpvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivg
  qkkareiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaal
  nadcdgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3t89F (F:)
  ypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalad
  aryddnigviiltgagdkafcsggdvhhlnvldfqrqirtcpkpvvamvagysiggghvl
  hmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqald
  mglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlf
  ymteegqegrnarqpdfskfkrnp