PDB entry 3svm

View 3svm on RCSB PDB site
Description: Human MPP8 - human DNMT3AK47me2 peptide
Class: transferase
Keywords: epigenetics, methyl-lysine binding, Chromodomain, The dimethylated human DNMT3AK47me2 is recognized by the chromodomain of MPP8, MPP8 chromodomain, dimethylated lysine, TRANSFERASE
Deposited on 2011-07-12, released 2011-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.257
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3svma_
  • Chain 'P':
    Compound: DNA (cytosine-5)-methyltransferase 3A
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6K1 (1-End)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3svmA (A:)
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
ak

    Sequence, based on observed residues (ATOM records): (download) 
    >3svmA (A:)
edvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenka

  • Chain 'P':
    No sequence available.