PDB entry 3su3

View 3su3 on RCSB PDB site
Description: Crystal structure of NS3/4A protease in complex with vaniprevir
Class: hydrolase/inhibitor
Keywords: drug resistance, drug design, Protease inhibitors, serine protease, VIRAL PROTEIN, HYDROLASE-INHIBITOR complex
Deposited on 2011-07-11, released 2012-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.165
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS3 protease, NS4A protein
    Species: Hepatitis C virus [TaxId:31646]
    Gene: NS3-NS4A
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8DG50 (6-20)
      • expression tag (0-5)
      • engineered mutation (6-9)
      • see remark 999 (11)
      • see remark 999 (18-19)
    • Uniprot A8DG50 (21-End)
      • engineered mutation (21-23)
      • engineered mutation (33-34)
      • engineered mutation (37-38)
      • engineered mutation (41)
      • engineered mutation (60)
      • engineered mutation (67)
      • engineered mutation (72)
      • engineered mutation (92)
      • engineered mutation (106)
      • engineered mutation (159)
      • engineered mutation (179)
    Domains in SCOPe 2.06: d3su3a1, d3su3a2
  • Heterogens: SU3, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3su3A (A:)
    gshmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivsta
    tqtflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctc
    gssdlylvtrhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavs
    trgvakavdfipveslettmrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3su3A (A:)
    gshmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivsta
    tqtflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctc
    gssdlylvtrhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavs
    trgvakavdfipveslettmr