PDB entry 3s7r

View 3s7r on RCSB PDB site
Description: Crystal structure of a Heterogeneous nuclear ribonucleoprotein A/B (HNRPAB) from HOMO SAPIENS at 2.15 A resolution
Class: RNA binding protein
Keywords: Ferredoxin-like, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, RNA BINDING PROTEIN
Deposited on 2011-05-26, released 2011-08-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.179
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterogeneous nuclear ribonucleoprotein A/B
    Species: Homo sapiens [TaxId:9606]
    Gene: ABBP1, BC009359, HNRNPAB, HNRPAB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Heterogeneous nuclear ribonucleoprotein A/B
    Species: Homo sapiens [TaxId:9606]
    Gene: ABBP1, BC009359, HNRNPAB, HNRPAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3s7rb_
  • Heterogens: UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s7rB (B:)
    ginaskneedagkmfvgglswdtskkdlkdyftkfgevvdctikmdpntgrsrgfgfilf
    kdaasvekvldqkehrldgrvidpkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s7rB (B:)
    eedagkmfvgglswdtskkdlkdyftkfgevvdctikmdpntgrsrgfgfilfkdaasve
    kvldqkehrldgrvidpkka