PDB entry 3rfn

View 3rfn on RCSB PDB site
Description: Epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins
Class: de novo protein
Keywords: protein grafting, flexible backbone design, epitope-scaffold, HIV, immunogen design, DE NOVO PROTEIN
Deposited on 2011-04-06, released 2011-11-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BB_1wnu_001
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: alaXS, PH0574
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58307 (0-43)
      • engineered mutation (20-21)
      • engineered mutation (24)
      • engineered mutation (29)
    • Uniprot O58307 (59-End)
    Domains in SCOPe 2.05: d3rfna_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3rfnA (A:)
ysievrthsalhvvkgavvkaagsaakwttstyvkgnkgvlivkaaleldkwawaameal
anekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeht
kttgeigpikirkvrfrkskglleihfellelehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3rfnA (A:)
ysievrthsalhvvkgavvkaagsaakwttstyvkgnkgvlivkaaleldkwawaameal
anekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeht
kttgeigpikirkvrfrkskglleihfelle