PDB entry 3qrs
View 3qrs on RCSB PDB site
Description: HIV-1 protease (mutant Q7K L33I L63I) in complex with a three-armed pyrrolidine-based inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Aspartyl Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2011-02-18, released
2012-02-22
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-02-22, with a file datestamp of
2012-02-17.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.214
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
Domains in SCOPe 2.02: d3qrsa_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
Domains in SCOPe 2.02: d3qrsb_ - Heterogens: CL, NK8, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3qrsA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3qrsB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf