PDB entry 3qlm

View 3qlm on RCSB PDB site
Description: Crystal structure of porcine pancreatic phospholipase A2 in complex with n-hexadecanoic acid
Class: hydrolase
Keywords: Hydrolase, Pla2, Pancreatic enzyme, palmitic acid binding
Deposited on 2011-02-03, released 2011-04-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2, major isoenzyme
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-123)
  Domains in SCOPe 2.05: d3qlma_
• Heterogens: CA, PLM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qlmA (A:)
  alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
  ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
  kkyc