PDB entry 3qjt

View 3qjt on RCSB PDB site
Description: The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from Thermus thermophilus
Class: oxidoreductase
Keywords: CYTOCHROME BA3 OXIDASE, Carbon monoxide, CO photodissociation, OXIDOREDUCTASE
Deposited on 2011-01-30, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA, TTHA1135
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-567)
      • conflict (263)
    Domains in SCOPe 2.07: d3qjta_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, ctaC, TTHA1134
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ80 (Start-167)
      • conflict (3)
    Domains in SCOPe 2.07: d3qjtb1, d3qjtb2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD, TTHA1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qjtc_
  • Heterogens: CU1, HEM, HAS, CMO, CUA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qjtA (A:)
    mhhhhhhavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypl
    lkrllpfvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmaf
    iglvvaalpllaneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaan
    pgkvtplvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghp
    ivyfwllpayaiiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptw
    kmihsvltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgll
    gfipggaggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpis
    daqrrlglavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlag
    ivllvalllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfava
    ailvvlaygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjtA (A:)
    seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy
    yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll
    aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym
    avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya
    iiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv
    avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv
    nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv
    wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi
    yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt
    lvqlfghlnpvpgwrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qjtB (B:)
    mvdqhkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjtB (B:)
    dqhkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qjtC (C:)
    meekpkgalavilvltltilvfwlgvyavffarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjtC (C:)
    eekpkgalavilvltltilvfwlgvyavffarg